PDB entry 1j1s

View 1j1s on RCSB PDB site
Description: Pokeweed Antiviral Protein from Seeds (PAP-S1) Complexed with Formycin
Class: hydrolase
Keywords: pokeweed antiviral protein, n-glycosidase, ribosome-inactivating protein, hydrolase
Deposited on 2002-12-14, released 2004-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antiviral protein s
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j1sa_
  • Heterogens: NAG, FMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j1sA (A:)
intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk
titlmlrrnnlyvmgysdpydnkcryhifndikgteysdventlcpssnprvakpinyng
lyptlekkagvtsrnevqlgiqilssdigkisgqgsftekieakfllvaiqmvseaarfk
yienqvktnfnrdfspndkvldleenwgkistaihnskngalpkplelknadgtkwivlr
vdeikpdvgllnyvngtcqat