PDB entry 1j1r

View 1j1r on RCSB PDB site
Description: structure of pokeweed antiviral protein from seeds (pap-s1) complexed with adenine
Deposited on 2002-12-14, released 2004-02-03
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1j1ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j1rA (A:)
    intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk
    titlmlrrnnlyvmgysdpydnkcryhifndikgteysdventlcpssnprvakpinyng
    lyptlekkagvtsrnevqlgiqilssdigkisgqgsftekieakfllvaiqmvseaarfk
    yienqvktnfnrdfspndkvldleenwgkistaihnskngalpkplelknadgtkwivlr
    vdeikpdvgllnyvngtcqat