PDB entry 1j1g

View 1j1g on RCSB PDB site
Description: Crystal structure of the RNase MC1 mutant N71S in complex with 5'-GMP
Class: hydrolase
Keywords: Hydrolase, Nucleic acid, RNA
Deposited on 2002-12-04, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease mc1
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23540 (1-189)
      • cloning artifact (0)
      • see remark 999 (39)
      • engineered (70)
      • see remark 999 (163)
    Domains in SCOPe 2.07: d1j1ga1, d1j1ga2
  • Heterogens: 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j1gA (A:)
    mdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
    lqsqlntlwpsvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
    haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstlidct
    rdtcganfif