PDB entry 1j1g

View 1j1g on RCSB PDB site
Description: crystal structure of the rnase mc1 mutant n71s in complex with 5'-gmp
Deposited on 2002-12-04, released 2003-05-20
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-20, with a file datestamp of 2003-05-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.217
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1j1ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j1gA (A:)
    mdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
    lqsqlntlwpsvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
    haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstlidct
    rdtcganfif