PDB entry 1j1e

View 1j1e on RCSB PDB site
Description: Crystal structure of the 52kDa domain of human cardiac troponin in the Ca2+ saturated form
Class: contractile protein
Keywords: Thin filament, muscle regulation, Ca2+ binding protein, EF-hand, coiled-coil, CONTRACTILE PROTEIN
Deposited on 2002-12-03, released 2003-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.251
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-160)
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.04: d1j1ea_
  • Chain 'B':
    Compound: Troponin T
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1j1eb_
  • Chain 'C':
    Compound: troponin I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19429
      • engineered (49)
      • engineered (66)
    Domains in SCOPe 2.04: d1j1ec_
  • Chain 'D':
    Compound: troponin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-160)
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.04: d1j1ed_
  • Chain 'E':
    Compound: Troponin T
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1j1ee_
  • Chain 'F':
    Compound: troponin I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19429
      • engineered (49)
      • engineered (66)
    Domains in SCOPe 2.04: d1j1ef_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1eA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
    lqatgetiteddieelmkdgdknndgridydeflefmkgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1eA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddkseeelsdlfrmfdknadgyidleelkimlqa
    tgetiteddieelmkdgdknndgridydeflefmkgve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j1eB (B:)
    hfggyiqkqaqterksgkrqterekkkkilaerrkvlaidhlnedqlrekakelwqtiyn
    leaekfdlqekfkqqkyeinvlrnrindnqkvsktrgkakvtgrwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1eB (B:)
    terekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqkyein
    vlrnrindn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j1eC (C:)
    mephakkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgf
    aelqdlarqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvris
    adammqallgarakesldlrahlkqvkkedtekenrevgdwrknidalsgmegrkkkfes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1eC (C:)
    akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq
    dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrvrisadammqallgar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j1eD (D:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
    lqatgetiteddieelmkdgdknndgridydeflefmkgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1eD (D:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlnptpeelqemid
    evdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkimlq
    atgetiteddieelmkdgdknndgridydeflefmkgve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1j1eE (E:)
    hfggyiqkqaqterksgkrqterekkkkilaerrkvlaidhlnedqlrekakelwqtiyn
    leaekfdlqekfkqqkyeinvlrnrindnqkvsktrgkakvtgrwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1eE (E:)
    qterekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqkyei
    nvlrnrindnqkvsk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1j1eF (F:)
    mephakkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgf
    aelqdlarqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvris
    adammqallgarakesldlrahlkqvkkedtekenrevgdwrknidalsgmegrkkkfes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1eF (F:)
    kisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdlarq
    lharvdkvdeerydieakvtkniteiadltqkifdlrrisadammqallgarakesldlr
    ahlkqvkkedtekenrevgdw