PDB entry 1j1d

View 1j1d on RCSB PDB site
Description: Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form
Class: contractile protein
Keywords: Thin filament, muscle regulation, Ca2+ binding protein, EF-hand, coiled-coil, CONTRACTILE PROTEIN
Deposited on 2002-12-03, released 2003-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.264
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-160)
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.04: d1j1da_
  • Chain 'B':
    Compound: Troponin T
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1j1db_
  • Chain 'C':
    Compound: troponin I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19429
      • engineered (49)
      • engineered (66)
    Domains in SCOPe 2.04: d1j1dc_
  • Chain 'D':
    Compound: troponin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (Start-160)
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.04: d1j1dd_
  • Chain 'E':
    Compound: Troponin T
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1j1de_
  • Chain 'F':
    Compound: troponin I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19429
      • engineered (49)
      • engineered (66)
    Domains in SCOPe 2.04: d1j1df_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1dA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
    lqatgetiteddieelmkdgdknndgridydeflefmkgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1dA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskseeelsdlfrmfdknadgyidleelkimlq
    atgetiteddieelmkdgdknndgridydeflefmkgve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j1dB (B:)
    hfggyiqkqaqterksgkrqterekkkkilaerrkvlaidhlnedqlrekakelwqtiyn
    leaekfdlqekfkqqkyeinvlrnrindnqkvsktrgkakvtgrwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1dB (B:)
    qterekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqkyei
    nvlrnrindn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j1dC (C:)
    mephakkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgf
    aelqdlarqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvris
    adammqallgara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1dC (C:)
    akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq
    dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrrrvrisadammqallg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j1dD (D:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
    lqatgetiteddieelmkdgdknndgridydeflefmkgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1dD (D:)
    ddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
    devdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkiml
    qatgetiteddieelmkdgdknndgridydeflefmkgve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1j1dE (E:)
    hfggyiqkqaqterksgkrqterekkkkilaerrkvlaidhlnedqlrekakelwqtiyn
    leaekfdlqekfkqqkyeinvlrnrindnqkvsktrgkakvtgrwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1dE (E:)
    krqterekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqky
    einvlrnrindnqkv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1j1dF (F:)
    mephakkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgf
    aelqdlarqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvris
    adammqallgara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1dF (F:)
    kkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdl
    arqlharvdkvdeerydieakvtkniteiadltqkifdlrgkisadammqallgar