PDB entry 1j1c

View 1j1c on RCSB PDB site
Description: Binary complex structure of human tau protein kinase I with ADP
Deposited on 2002-12-03, released 2003-12-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1j1ca_
  • Chain 'B':
    Domains in SCOP 1.71: d1j1cb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1cA (A:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1cA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j1cB (B:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1cB (B:)
    fgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelv
    aikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrv
    arhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfg
    sakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsg
    vdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlle
    ytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha
    riqa