PDB entry 1j17

View 1j17 on RCSB PDB site
Description: factor xa specific inhibitor in complex with rat trypsin mutant x99/175/190rt
Class: hydrolase
Keywords: serine protease, hydrolase, serine proteinase
Deposited on 2002-11-30, released 2002-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Compound: trypsin II, anionic
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (78)
      • engineered (80)
      • engineered (151-154)
      • engineered (171)
    Domains in SCOPe 2.05: d1j17t_
  • Heterogens: CA, SO4, ZEN, HOH

PDB Chain Sequences:

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j17T (T:)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdretynndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasssfiitdnmvcvgfleggkdacqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan