PDB entry 1j16

View 1j16 on RCSB PDB site
Description: benzamidine in complex with rat trypsin mutant x99/175/190rt
Deposited on 2002-11-30, released 2002-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-11, with a file datestamp of 2003-02-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1j16a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j16A (A:)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdretynndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasssfiitdnmvcvgfleggkdacqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan