PDB entry 1j0x

View 1j0x on RCSB PDB site
Description: Crystal structure of the rabbit muscle glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, dehydrogenase, Rossmann fold, mammalian GAPDH, apoptosis, negative cooperativity
Deposited on 2002-11-25, released 2003-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46406 (0-331)
      • see remark 999 (122)
      • modified residue (148)
      • see remark 999 (285)
    Domains in SCOPe 2.06: d1j0xo1, d1j0xo2
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46406 (0-331)
      • see remark 999 (122)
      • modified residue (148)
      • see remark 999 (285)
    Domains in SCOPe 2.06: d1j0xp1, d1j0xp2
  • Chain 'Q':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46406 (0-331)
      • see remark 999 (122)
      • modified residue (148)
      • see remark 999 (285)
    Domains in SCOPe 2.06: d1j0xq1, d1j0xq2
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46406 (0-331)
      • see remark 999 (122)
      • modified residue (148)
      • see remark 999 (285)
    Domains in SCOPe 2.06: d1j0xr1, d1j0xr2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0xO (O:)
    vkvgvngfgrigrlvtraafnsgkvdvvaindpfidlhymvymfqydsthgkfhgtvkae
    ngklvingkaitifqerdpanikwgdagaeyvvestgvfttmekagahlkggakrviisa
    psadapmfvmgvnhekydnslkivsnascttnclaplakvihdhfgiveglmttvhaita
    tqktvdgpsgklwrdgrgaaqniipastgaakavgkvipelngkltgmafrvptpnvsvv
    dltcrlekaakyddikkvvkqasegplkgilgytedqvvscdfnsdthsstfdagagial
    ndhfvkliswydnefgysnrvvdlmvhmaske
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0xP (P:)
    vkvgvngfgrigrlvtraafnsgkvdvvaindpfidlhymvymfqydsthgkfhgtvkae
    ngklvingkaitifqerdpanikwgdagaeyvvestgvfttmekagahlkggakrviisa
    psadapmfvmgvnhekydnslkivsnascttnclaplakvihdhfgiveglmttvhaita
    tqktvdgpsgklwrdgrgaaqniipastgaakavgkvipelngkltgmafrvptpnvsvv
    dltcrlekaakyddikkvvkqasegplkgilgytedqvvscdfnsdthsstfdagagial
    ndhfvkliswydnefgysnrvvdlmvhmaske
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0xQ (Q:)
    vkvgvngfgrigrlvtraafnsgkvdvvaindpfidlhymvymfqydsthgkfhgtvkae
    ngklvingkaitifqerdpanikwgdagaeyvvestgvfttmekagahlkggakrviisa
    psadapmfvmgvnhekydnslkivsnascttnclaplakvihdhfgiveglmttvhaita
    tqktvdgpsgklwrdgrgaaqniipastgaakavgkvipelngkltgmafrvptpnvsvv
    dltcrlekaakyddikkvvkqasegplkgilgytedqvvscdfnsdthsstfdagagial
    ndhfvkliswydnefgysnrvvdlmvhmaske
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0xR (R:)
    vkvgvngfgrigrlvtraafnsgkvdvvaindpfidlhymvymfqydsthgkfhgtvkae
    ngklvingkaitifqerdpanikwgdagaeyvvestgvfttmekagahlkggakrviisa
    psadapmfvmgvnhekydnslkivsnascttnclaplakvihdhfgiveglmttvhaita
    tqktvdgpsgklwrdgrgaaqniipastgaakavgkvipelngkltgmafrvptpnvsvv
    dltcrlekaakyddikkvvkqasegplkgilgytedqvvscdfnsdthsstfdagagial
    ndhfvkliswydnefgysnrvvdlmvhmaske