PDB entry 1j0w

View 1j0w on RCSB PDB site
Description: Crystal Structure Analysis of the Dok-5 PTB Domain
Class: transferase
Keywords: beta strands, alfa helix, transferase
Deposited on 2002-11-25, released 2003-12-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: downstream of tyrosine kinase 5
  Species: Homo sapiens [TaxId:9606]
  Gene: DOK5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P104 (Start-99)
    • modified residue (11)
    • modified residue (68)
    • cloning artifact (100)
  Domains in SCOPe 2.02: d1j0wa_
• Chain 'B':
  Compound: downstream of tyrosine kinase 5
  Species: Homo sapiens [TaxId:9606]
  Gene: DOK5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P104 (0-99)
    • modified residue (11)
    • modified residue (68)
    • cloning artifact (100-102)
  Domains in SCOPe 2.02: d1j0wb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1j0wA (A:)
  reqserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdtt
  wftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeler
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1j0wA (A:)
  qserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdttwf
  tfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiael
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j0wB (B:)
  reqserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdtt
  wftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeler