PDB entry 1j0w

View 1j0w on RCSB PDB site
Description: Crystal Structure Analysis of the Dok-5 PTB Domain
Deposited on 2002-11-25, released 2003-12-16
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1j0wa_
  • Chain 'B':
    Domains in SCOP 1.71: d1j0wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j0wA (A:)
    reqserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdtt
    wftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeler
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j0wA (A:)
    qserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdttwf
    tfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiael
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0wB (B:)
    reqserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdtt
    wftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeler