PDB entry 1j0w

View 1j0w on RCSB PDB site
Description: Crystal Structure Analysis of the Dok-5 PTB Domain
Class: transferase
Keywords: beta strands, alfa helix, transferase
Deposited on 2002-11-25, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: downstream of tyrosine kinase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: DOK5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P104 (Start-99)
      • modified residue (11)
      • modified residue (68)
      • cloning artifact (100)
    Domains in SCOPe 2.07: d1j0wa1, d1j0wa2
  • Chain 'B':
    Compound: downstream of tyrosine kinase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: DOK5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P104 (0-99)
      • modified residue (11)
      • modified residue (68)
      • cloning artifact (100-102)
    Domains in SCOPe 2.07: d1j0wb1, d1j0wb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j0wA (A:)
    reqserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdtt
    wftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeler
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j0wA (A:)
    qserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdttwf
    tfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiael
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0wB (B:)
    reqserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdtt
    wftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeler