PDB entry 1j0s

View 1j0s on RCSB PDB site
Description: Solution structure of the human interleukin-18
Class: cytokine
Keywords: beta trefoil, cytokine
Deposited on 2002-11-21, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j0sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0sA (A:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned