PDB entry 1j0q

View 1j0q on RCSB PDB site
Description: Solution Structure of Oxidized Bovine Microsomal Cytochrome b5 mutant V61H
Class: electron transport
Keywords: helix, beta, electron transport
Deposited on 2002-11-20, released 2003-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00171 (0-81)
    • engineered (58)
  Domains in SCOPe 2.07: d1j0qa_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j0qA (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedhg
  hstdarelsktfiigelhpddr