PDB entry 1j0p

View 1j0p on RCSB PDB site
Description: Three dimensional Structure of the Y43L mutant of Tetraheme Cytochrome c3 from Desulfovibrio vulgaris Miyazaki F
Class: Electron transport
Keywords: tetraheme cytochrome c3, high resolution X-ray structure, Y43L mutant, Electron transport
Deposited on 2002-11-19, released 2003-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.91 Å
R-factor: 0.106
AEROSPACI score: 1.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00132 (0-107)
      • engineered (43)
    Domains in SCOPe 2.06: d1j0pa_
  • Heterogens: SO4, HEM, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0pA (A:)
    aapkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedlqkcatagchdnmdkkd
    ksakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs