PDB entry 1j0o

View 1j0o on RCSB PDB site
Description: High Resolution Crystal Structure of the wild type Tetraheme Cytochrome c3 from Desulfovibrio vulgaris Miyazaki F
Class: electron transport
Keywords: tetraheme cytochrome c3, high resolution X-ray structure, wild type, Electron transport
Deposited on 2002-11-19, released 2003-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio vulgaris [TaxId:881]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00132 (0-106)
  Domains in SCOPe 2.08: d1j0oa_
• Heterogens: HEM, EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j0oA (A:)
  apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
  sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs