PDB entry 1j0o

View 1j0o on RCSB PDB site
Description: High Resolution Crystal Structure of the wild type Tetraheme Cytochrome c3 from Desulfovibrio vulgaris Miyazaki F
Class: Electron transport
Keywords: tetraheme cytochrome c3, high resolution X-ray structure, wild type, Electron transport
Deposited on 2002-11-19, released 2003-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.108
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j0oa_
  • Heterogens: HEM, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0oA (A:)
    apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
    sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs