PDB entry 1j0g

View 1j0g on RCSB PDB site
Description: Solution Structure of Mouse Hypothetical 9.1 kDa Protein, A Ubiquitin-like Fold
Class: structural genomics, unknown function
Keywords: Hypothetical protein, Ubiquitin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2002-11-13, released 2003-12-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-12-09, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical Protein 1810045K17
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 1810045K17
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61961 (7-91)
    • cloning artifact (0-6)
  Domains in SCOP 1.75: d1j0ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j0gA (A:)
  gsegaatmskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitnd
  giginpaqtagnvflkhgselriiprdrvgsc