PDB entry 1j0f

View 1j0f on RCSB PDB site
Description: Solution Structure of the SH3 Domain Binding Glutamic Acid-rich Protein Like 3
Class: structural genomics, unknown function
Keywords: thioredoxin fold, SH3BGR, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2002-11-12, released 2003-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 domain-binding glutamic acid-rich-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1110004L05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VW3 (7-99)
      • cloning artifact (0-6)
    Domains in SCOPe 2.06: d1j0fa1, d1j0fa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0fA (A:)
    gsegaatmsglrvystsvtgsreiksqqsevtrildgkriqyqlvdisqdnalrdemrtl
    agnpkatppqivngnhycgdyelfveaveqdtlqeflkla