PDB entry 1j08

View 1j08 on RCSB PDB site
Description: Crystal structure of glutaredoxin-like protein from Pyrococcus horikoshii
Class: isomerase
Keywords: alpha/beta, isomerase
Deposited on 2002-11-11, released 2003-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin-like protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j08a1, d1j08a2
  • Chain 'B':
    Compound: glutaredoxin-like protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j08b1, d1j08b2
  • Chain 'C':
    Compound: glutaredoxin-like protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j08c1, d1j08c2
  • Chain 'D':
    Compound: glutaredoxin-like protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j08d1, d1j08d2
  • Chain 'E':
    Compound: glutaredoxin-like protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j08e1, d1j08e2
  • Chain 'F':
    Compound: glutaredoxin-like protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j08f1, d1j08f2
  • Chain 'G':
    Compound: glutaredoxin-like protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j08g1, d1j08g2
  • Chain 'H':
    Compound: glutaredoxin-like protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j08h1, d1j08h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j08A (A:)
    mgliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtd
    lmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j08A (A:)
    gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
    fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtdl
    mqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaiey
    pewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j08B (B:)
    mgliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtd
    lmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j08B (B:)
    gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
    fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtdl
    mqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaiey
    pewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j08C (C:)
    mgliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtd
    lmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j08C (C:)
    gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
    fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtdl
    mqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaiey
    pewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j08D (D:)
    mgliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtd
    lmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j08D (D:)
    gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
    fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtdl
    mqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaiey
    pewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1j08E (E:)
    mgliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtd
    lmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j08E (E:)
    gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
    fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtdl
    mqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaiey
    pewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1j08F (F:)
    mgliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtd
    lmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j08F (F:)
    gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
    fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtdl
    mqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaiey
    pewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1j08G (G:)
    mgliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtd
    lmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j08G (G:)
    gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
    fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtdl
    mqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaiey
    pewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1j08H (H:)
    mgliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtd
    lmqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedkvqfegaypekmflekllsals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j08H (H:)
    gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
    fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdtdl
    mqdskeevskidkdvrilifvtptcpycplavrmahkfaientkagkgkilgdmveaiey
    pewadqynvmavpkiviqvngedkvqfegaypekmflekllsals