PDB entry 1j03

View 1j03 on RCSB PDB site
Description: Solution structure of a putative steroid-binding protein from Arabidopsis
Class: structural genomics, unknown function
Keywords: alpha and beta, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2002-10-29, released 2003-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative steroid binding protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g24940
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SK39 (2-101)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1j03a1, d1j03a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j03A (A:)
    gpmeftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkdasralgk
    mskneedvspslegltekeintlndwetkfeakypvvgrvvs