PDB entry 1j03

View 1j03 on RCSB PDB site
Description: solution structure of a putative steroid-binding protein from arabidopsis
Deposited on 2002-10-29, released 2003-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1j03a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j03A (A:)
    gpmeftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkdasralgk
    mskneedvspslegltekeintlndwetkfeakypvvgrvvs