PDB entry 1j02

View 1j02 on RCSB PDB site
Description: Crystal Structure of Rat Heme Oxygenase-1-Heme Bound to NO
Class: oxidoreductase
Keywords: alpha helix, O2-analog bound form
Deposited on 2002-10-28, released 2003-09-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1j02a_
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j02A (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j02A (A:)
    qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
    npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
    ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
    mtpevkhrvteeaktafllnielfeelqallt