PDB entry 1j01

View 1j01 on RCSB PDB site
Description: Crystal Structure Of The Xylanase Cex With Xylobiose-Derived Inhibitor Isofagomine lactam
Class: hydrolase
Keywords: CEX, XYLANASE, DEOXYNOJIRIMYCIN INHIBITOR, CELLULOSE DEGRADATION, hydrolase
Deposited on 2002-10-25, released 2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1,4-xylanase
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Gene: Cex
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j01a_
  • Heterogens: XIL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j01A (A:)
    attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
    gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
    swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
    nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
    psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
    kkpayaavmeaf