PDB entry 1j00

View 1j00 on RCSB PDB site
Description: E. coli Thioesterase I/Protease I/Lysophospholipase L1 in complexed with diethyl phosphono moiety
Class: hydrolase
Keywords: Hydrolase, Protease
Deposited on 2002-10-18, released 2003-07-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.239
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioesterase I
    Species: Escherichia coli [TaxId:562]
    Gene: tesA/apeA/pldC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29679 (0-End)
      • modified residue (9)
    Domains in SCOPe 2.02: d1j00a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j00A (A:)
    adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
    hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
    fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh
    dslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j00A (A:)
    adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
    qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryneaf
    saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvh