PDB entry 1izr

View 1izr on RCSB PDB site
Description: F46A mutant of bovine pancreatic ribonuclease A
Class: hydrolase
Keywords: ribonuclease, RNAse a, bovine pancreas, hydrolase
Deposited on 2002-10-11, released 2003-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.198
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered (45)
  Domains in SCOPe 2.05: d1izra_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1izrA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntavhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv