PDB entry 1izq

View 1izq on RCSB PDB site
Description: f46v mutant of bovine pancreatic ribonuclease a
Deposited on 2002-10-11, released 2003-11-25
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-02, with a file datestamp of 2003-12-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1izqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1izqA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntvvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv