PDB entry 1izm

View 1izm on RCSB PDB site
Description: Structure of ygfB from Haemophilus influenzae (HI0817), a Conserved Hypothetical Protein
Class: structural genomics, unknown function
Keywords: Structural genomics, hypothetical protein, HI0817, ygfB, Structure 2 Function Project, S2F, UNKNOWN FUNCTION
Deposited on 2002-10-09, released 2003-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein hi0817
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0817
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44882
      • engineered (9)
      • modified residue (165)
    Domains in SCOPe 2.08: d1izma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1izmA (A:)
    gsmlishsdmnqqlksagigfnatelhgflsgllcgglkdqswlpllyqfsndnhayptg
    lvqpvtelyeqisqtlsdvegftfelgltedenvftqadslsdwanqfllgiglaqpela
    kekgeigeavddlqdicqlgydeddneeelaealeeiieyvrtiamlfyshfnegeiesk
    pvlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1izmA (A:)
    lishsdmnqqlksagigfnatelhgflsgllcgglkdqswlpllyqfsndnhayptglvq
    pvtelyeqisqtlsdvegftfelgltedenvftqadslsdwanqfllgiglaqpelakek
    geigeavddlqdicqlgydeddneeelaealeeiieyvrtiamlfyshfn