PDB entry 1izj

View 1izj on RCSB PDB site
Description: Thermoactinomyces vulgaris R-47 alpha-amylase 1 mutant enzyme f313a
Class: hydrolase
Keywords: alpha-beta barrele
Deposited on 2002-10-03, released 2003-07-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-07-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylase
    Species: Thermoactinomyces vulgaris
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60053 (0-636)
      • engineered (312)
    Domains in SCOP 1.75: d1izja1, d1izja2, d1izja3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1izjA (A:)
    aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
    vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
    ipnfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgyd
    nslvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnst
    lqtlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytf
    ytwpdsyasflganslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrldaaqy
    vdangnngsdvtnhqiwsefrnavkgvnsnaaiigeywgnanpwtaqgnqwdaatnfdgf
    tqpvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrs
    ggdlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqk
    litirnqypalrtgsfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqls
    mpngstvtdkitghsytvqngmvtvavdghygavlaq