PDB entry 1izi

View 1izi on RCSB PDB site
Description: Inhibitor of HIV protease with unusual binding mode potently inhibiting multi-resistant protease mutants
Class: hydrolase
Keywords: HIV-1 proteinase, triple mutant, potent inhibitor, subsite binding, hydrolase
Deposited on 2002-10-02, released 2002-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: proteinase
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90EB9 (0-98)
    • engineered (70)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.06: d1izia_
• Chain 'B':
  Compound: proteinase
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90EB9 (0-98)
    • engineered (70)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.06: d1izib_
• Heterogens: CL, Q50, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iziA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkvigtvlvgptptnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iziB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkvigtvlvgptptnvigrnlltqigctlnf