PDB entry 1izi
View 1izi on RCSB PDB site
Description: Inhibitor of HIV protease with unusual binding mode potently inhibiting multi-resistant protease mutants
Class: hydrolase
Keywords: HIV-1 proteinase, triple mutant, potent inhibitor, subsite binding, hydrolase
Deposited on
2002-10-02, released
2002-12-23
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: proteinase
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot Q90EB9 (0-98)
- engineered (70)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.04: d1izia_ - Chain 'B':
Compound: proteinase
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot Q90EB9 (0-98)
- engineered (70)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.04: d1izib_ - Heterogens: CL, Q50, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1iziA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1iziB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf