PDB entry 1izi

View 1izi on RCSB PDB site
Description: Inhibitor of HIV protease with unusual binding mode potently inhibiting multi-resistant protease mutants
Class: hydrolase
Keywords: HIV-1 proteinase, triple mutant, potent inhibitor, subsite binding, hydrolase
Deposited on 2002-10-02, released 2002-12-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteinase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90EB9 (0-98)
      • engineered (70)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.04: d1izia_
  • Chain 'B':
    Compound: proteinase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90EB9 (0-98)
      • engineered (70)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.04: d1izib_
  • Heterogens: CL, Q50, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iziA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkvigtvlvgptptnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iziB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkvigtvlvgptptnvigrnlltqigctlnf