PDB entry 1izi

View 1izi on RCSB PDB site
Description: inhibitor of hiv protease with unusual binding mode potently inhibiting multi-resistant protease mutants
Deposited on 2002-10-02, released 2002-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 2002-12-23, with a file datestamp of 2002-12-23.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1izia_
  • Chain 'B':
    Domains in SCOP 1.69: d1izib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iziA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkvigtvlvgptptnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iziB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkvigtvlvgptptnvigrnlltqigctlnf