PDB entry 1izh

View 1izh on RCSB PDB site
Description: Inhibitor of HIV protease with unusual binding mode potently inhibiting multi-resistant protease mutants
Class: hydrolase
Keywords: HIV-1 proteinase, potent inhibitor, subsite binding
Deposited on 2002-10-02, released 2002-12-23
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: proteinase
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90EB9 (0-98)
  Domains in SCOP 1.75: d1izha_
• Chain 'B':
  Compound: proteinase
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90EB9 (0-98)
  Domains in SCOP 1.75: d1izhb_
• Heterogens: Q50, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1izhA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1izhB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf