PDB entry 1ize

View 1ize on RCSB PDB site
Description: Crystal structure of Aspergillus oryzae Aspartic proteinase complexed with pepstatin
Class: hydrolase/hydrolase inhibitor
Keywords: acid protease, sugar binding, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2002-10-02, released 2003-03-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartic proteinase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1izea_
  • Chain 'B':
    Compound: pepstatin
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1IZE (0-5)
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1izeA (A:)
    aatgsvttnptsndeeyitqvtvgddtlgldfdtgsadlwvfssqtpssersghdyytpg
    ssaqkidgatwsisygdgssasgdvykdkvtvggvsydsqavesaekvsseftqdtandg
    llglafssintvqptpqktffdnvksslsepifavalkhnapgvydfgytdsskytgsit
    ytdvdnsqgfwgftadgysigsdsssdsitgiadtgttllllddsivdayyeqvngasyd
    ssqggyvfpssaslpdfsvtigdytatvpgeyisfadvgngqtfggiqsnsgigfsifgd
    vflksqyvvfdasgprlgfaaqa
    

  • Chain 'B':
    No sequence available.