PDB entry 1izd

View 1izd on RCSB PDB site
Description: Crystal structure of Aspergillus oryzae Aspartic Proteinase
Class: hydrolase
Keywords: sugar binding, acid protease, HYDROLASE
Deposited on 2002-10-02, released 2003-03-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartic proteinase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1izda_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1izdA (A:)
    aatgsvttnptsndeeyitqvtvgddtlgldfdtgsadlwvfssqtpssersghdyytpg
    ssaqkidgatwsisygdgssasgdvykdkvtvggvsydsqavesaekvsseftqdtandg
    llglafssintvqptpqktffdnvksslsepifavalkhnapgvydfgytdsskytgsit
    ytdvdnsqgfwgftadgysigsdsssdsitgiadtgttllllddsivdayyeqvngasyd
    ssqggyvfpssaslpdfsvtigdytatvpgeyisfadvgngqtfggiqsnsgigfsifgd
    vflksqyvvfdasgprlgfaaqa