PDB entry 1izc

View 1izc on RCSB PDB site
Description: crystal structure analysis of macrophomate synthase
Deposited on 2002-10-01, released 2003-04-01
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1izca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1izcA (A:)
    maksyseqpelhakapyrsamltypgnlrqalkdamadpsktlmgvahgipstfvtkvla
    atkpdfvwidvehgmfnrlelhdaihaaqhhsegrslvivrvpkhdevslstaldagaag
    iviphvetveevrefvkemyygpigrrsfspwtfspgiadaslfpndpynvatsnnhvci
    ipqiesvkgvenvdaiaampeihglmfgpgdymidagldlngalsgvphptfveamtkfs
    taaqrngvpifggalsvdmvpslieqgyraiavqfdvwglsrlvhgslaqarasakqfag
    qgkaatdgttdetvdgaaeevangvskvkldeagdedka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1izcA (A:)
    aksyseqpelhakapyrsamltypgnlrqalkdamadpsktlmgvahgipstfvtkvlaa
    tkpdfvwidvehgmfnrlelhdaihaaqhhsegrslvivrvpkhdevslstaldagaagi
    viphvetveevrefvkemyygpigrrsfspwtfspgiadaslfpndpynvatsnnhvcii
    pqiesvkgvenvdaiaampeihglmfgpgdymidagldlngalsgvphptfveamtkfst
    aaqrngvpifggalsvdmvpslieqgyraiavqfdvwglsrlvhgslaqarasakqfag