PDB entry 1iza

View 1iza on RCSB PDB site
Description: role of b13 glu in insulin assembly: the hexamer structure of recombinant mutant (b13 glu-> gln) insulin
Deposited on 1992-10-16, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.154
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1iza.1
  • Chain 'B':
    Domains in SCOP 1.55: d1iza.1
  • Chain 'C':
    Domains in SCOP 1.55: d1iza.2
  • Chain 'D':
    Domains in SCOP 1.55: d1iza.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1izaA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1izaB (B:)
fvnqhlcgshlvqalylvcgergffytpkt

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1izaC (C:)
giveqcctsicslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1izaD (D:)
fvnqhlcgshlvqalylvcgergffytpkt