PDB entry 1iz6

View 1iz6 on RCSB PDB site
Description: Crystal Structure of Translation Initiation Factor 5A from Pyrococcus Horikoshii
Deposited on 2002-09-25, released 2003-01-28
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-28, with a file datestamp of 2003-01-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iz6A (A:)
    gdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivkp
    tsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginvey
    wetlgrikimrikgeg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iz6B (B:)
    gdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivkp
    tsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginvey
    wetlgrikimrikgeg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iz6C (C:)
    gdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivkp
    tsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginvey
    wetlgrikimrikge