PDB entry 1iz6

View 1iz6 on RCSB PDB site
Description: Crystal Structure of Translation Initiation Factor 5A from Pyrococcus Horikoshii
Class: Biosynthetic protein
Keywords: SH3-like barrel, OB fold, Biosynthetic protein
Deposited on 2002-09-25, released 2003-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Initiation Factor 5A
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iz6a1, d1iz6a2
  • Chain 'B':
    Compound: Initiation Factor 5A
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iz6b1, d1iz6b2
  • Chain 'C':
    Compound: Initiation Factor 5A
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iz6c1, d1iz6c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iz6A (A:)
    mgdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivk
    ptsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginve
    ywetlgrikimrikgege
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iz6A (A:)
    gdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivkp
    tsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginvey
    wetlgrikimrikgeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iz6B (B:)
    mgdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivk
    ptsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginve
    ywetlgrikimrikgege
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iz6B (B:)
    gdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivkp
    tsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginvey
    wetlgrikimrikgeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iz6C (C:)
    mgdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivk
    ptsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginve
    ywetlgrikimrikgege
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iz6C (C:)
    gdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivkp
    tsaevdvpiidkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginvey
    wetlgrikimrikge