PDB entry 1iz1

View 1iz1 on RCSB PDB site
Description: crystal structure of cbnr, a lysr family transcriptional regulator
Class: DNA binding protein
Keywords: long alpha helix connecting DNA binding and regulatory domains, DNA binding protein
Deposited on 2002-09-18, released 2003-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LysR-type regulatory protein
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iz1a1, d1iz1a2
  • Chain 'B':
    Compound: LysR-type regulatory protein
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iz1b1, d1iz1b2
  • Chain 'P':
    Compound: LysR-type regulatory protein
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iz1p1, d1iz1p2
  • Chain 'Q':
    Compound: LysR-type regulatory protein
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iz1q1, d1iz1q2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iz1A (A:)
    mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
    ghafledarrilelagrsgdrsraaargdvgelsvayfgtpiyrslplllrafltstpta
    tvslthmtkdeqvegllagtihvgfsrffprhpgieivniaqedlylavhrsqsgkfgkt
    ckladlraveltlfprggrpsfadeviglfkhagiepriarvvedataalaltmagaass
    ivpasvaairwpdiafarivgtrvkvpiscifrkekqppilarfvehvrrsakd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iz1A (A:)
    mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
    ghafledarrilelagrsgdrsraaargdvgelsvayfgtpiyrslplllrafltstpta
    tvslthmtkdeqvegllagtihvgfsrffprhpgieivniaqedlylavhrsqsgkfgkt
    ckladlraveltlfprggrpsfadeviglfkhagiepriarvvedataalaltmagaass
    ivpasvaairwpdiafarivgtrvkvpiscifrkekqppilarfvehvrrsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iz1B (B:)
    mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
    ghafledarrilelagrsgdrsraaargdvgelsvayfgtpiyrslplllrafltstpta
    tvslthmtkdeqvegllagtihvgfsrffprhpgieivniaqedlylavhrsqsgkfgkt
    ckladlraveltlfprggrpsfadeviglfkhagiepriarvvedataalaltmagaass
    ivpasvaairwpdiafarivgtrvkvpiscifrkekqppilarfvehvrrsakd
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1iz1P (P:)
    mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
    ghafledarrilelagrsgdrsraaargdvgelsvayfgtpiyrslplllrafltstpta
    tvslthmtkdeqvegllagtihvgfsrffprhpgieivniaqedlylavhrsqsgkfgkt
    ckladlraveltlfprggrpsfadeviglfkhagiepriarvvedataalaltmagaass
    ivpasvaairwpdiafarivgtrvkvpiscifrkekqppilarfvehvrrsakd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iz1P (P:)
    mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
    ghafledarrilelagrsgdrsraaargdvgelsvayfgtpiyrslplllrafltstpta
    tvslthmtkdeqvegllagtihvgfsrffprhpgieivniaqedlylavhrsqsgkfgkt
    ckladlraveltlfprggrpsfadeviglfkhagiepriarvvedataalaltmagaass
    ivpasvaairwpdiafarivgtrvkvpiscifrkekqppilarfvehvrrsa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1iz1Q (Q:)
    mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
    ghafledarrilelagrsgdrsraaargdvgelsvayfgtpiyrslplllrafltstpta
    tvslthmtkdeqvegllagtihvgfsrffprhpgieivniaqedlylavhrsqsgkfgkt
    ckladlraveltlfprggrpsfadeviglfkhagiepriarvvedataalaltmagaass
    ivpasvaairwpdiafarivgtrvkvpiscifrkekqppilarfvehvrrsakd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iz1Q (Q:)
    mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa
    ghafledarrilelagrsgdrsraaargdvgelsvayfgtpiyrslplllrafltstpta
    tvslthmtkdeqvegllagtihvgfsrffprhpgieivniaqedlylavhrsqsgkfgkt
    ckladlraveltlfprggrpsfadeviglfkhagiepriarvvedataalaltmagaass
    ivpasvaairwpdiafarivgtrvkvpiscifrkekqppilarfvehvrrsa