PDB entry 1iz0

View 1iz0 on RCSB PDB site
Description: Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH
Deposited on 2002-09-17, released 2003-07-15
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iz0A (A:)
    mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipg
    mevvgvvegrryaalvpqgglaervavpkgallplpeglspeeaaafpvsfltaylalkr
    aqarpgekvlvqaaagalgtaavqvaramglrvlaaasrpeklalplalgaeeaatyaev
    perakawggldlvlevrgkeveeslgllahggrlvyigaaegevapipplrlmrrnlavl
    gfwltpllregalveealgfllprlgrelrpvvgpvfpfaeaeaafralldrghtgkvvv
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iz0A (A:)
    mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipg
    mevvgvvegrryaalvpqgglaervavpkgallplpeglspeeaaafpvsfltaylalkr
    aqarpgekvlvqaaagalgtaavqvaramglrvlaaasrpeklalplalgaeeaatyaev
    perakawggldlvlevrgkeveeslgllahggrlvyiapipplrlmrrnlavlgfwltpl
    lregalveealgfllprlgrelrpvvgpvfpfaeaeaafralldrghtgkvvvrl