PDB entry 1iyw

View 1iyw on RCSB PDB site
Description: Preliminary Structure of Thermus thermophilus Ligand-Free Valyl-tRNA Synthetase
Class: ligase
Keywords: Rossmann Fold, Coiled Coil, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE
Deposited on 2002-09-10, released 2003-06-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.316
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iywA (A:)
    mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
    dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
    sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
    ttlsdleveteptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllg
    kraripltevwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrm
    egervpealrgldrfearrkavelfreaghlvkeedytialatcsrcgtpieyaifpqww
    lrmrplaeevlkglrrgdiafvperwkkvnmdwlenvkdwnisrqlwwghqipawycedc
    qavnvprperyledptsceacgsprlkrdedvfdtwfssalwplstlgwpeetedlkafy
    pgdvlvtgydilflwvsrmevsgyhfmgerpfktvllhglvldekgqkmskskgnvidpl
    emverygadalrfaliylatggqdirldlrwlemarnfanklynaarfvllsregfqake
    dtptladrfmrsrlsrgveeitalyealdlaqaarevyelvwsefcdwyleaakpalkag
    nahtlrtleevlavllkllhpmmpfltselyqaltgkeelaleawpepggrdeeaerafe
    alkqavtavralkaeaglppaqevrvylegetapveenlevfrflsradllperpakalv
    kamprvtarmpleglldveewrrrqekrlkellalaersqrklaspgfrekapkevveae
    earlkenleqaerirealsqig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iywB (B:)
    mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
    dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
    sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
    ttlsdleveteptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllg
    kraripltevwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrm
    egervpealrgldrfearrkavelfreaghlvkeedytialatcsrcgtpieyaifpqww
    lrmrplaeevlkglrrgdiafvperwkkvnmdwlenvkdwnisrqlwwghqipawycedc
    qavnvprperyledptsceacgsprlkrdedvfdtwfssalwplstlgwpeetedlkafy
    pgdvlvtgydilflwvsrmevsgyhfmgerpfktvllhglvldekgqkmskskgnvidpl
    emverygadalrfaliylatggqdirldlrwlemarnfanklynaarfvllsregfqake
    dtptladrfmrsrlsrgveeitalyealdlaqaarevyelvwsefcdwyleaakpalkag
    nahtlrtleevlavllkllhpmmpfltselyqaltgkeelaleawpepggrdeeaerafe
    alkqavtavralkaeaglppaqevrvylegetapveenlevfrflsradllperpakalv
    kamprvtarmpleglldveewrrrqekrlkellalaersqrklaspgfrekapkevveae
    earlkenleqaerirealsqig