PDB entry 1iys

View 1iys on RCSB PDB site
Description: Crystal Structure of Class A beta-Lactamase Toho-1
Class: hydrolase
Keywords: two-domain structure, HYDROLASE
Deposited on 2002-09-06, released 2003-10-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.182
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase toho-1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1iysa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iysA (A:)
    mnsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqses
    dkhllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpd
    kvtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraq
    lvtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqp
    eqkaerrrdilaaaakivthgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iysA (A:)
    nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
    khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
    vtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraql
    vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
    qkaerrrdilaaaakivthgf