PDB entry 1iyp

View 1iyp on RCSB PDB site
Description: toho-1 beta-lactamase in complex with cephalothin
Deposited on 2002-09-04, released 2002-12-11
The last revision prior to the SCOP 1.69 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1iypa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iypA (A:)
    ansvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqses
    dkhllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpd
    kvtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraq
    lvtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqp
    eqkaerrrdilaaaakivthgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iypA (A:)
    svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
    hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
    tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
    twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
    kaerrrdilaaaakivthgf