PDB entry 1iyo

View 1iyo on RCSB PDB site
Description: Toho-1 beta-Lactamase In Complex With Cefotaxime
Class: hydrolase
Keywords: extended-spectrum, ESBL, BETA-LACTAMASE, ACYL-ENZYME, cefotaxime, complex, HYDROLASE
Deposited on 2002-09-04, released 2002-12-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toho-1 beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (Start-261)
      • engineered (139)
    Domains in SCOPe 2.01: d1iyoa_
  • Heterogens: SO4, CEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iyoA (A:)
    ansvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqses
    dkhllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpd
    kvtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraq
    lvtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqp
    eqkaerrrdilaaaakivthgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iyoA (A:)
    svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
    hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
    tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
    twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
    kaerrrdilaaaakivthgf