PDB entry 1iyn

View 1iyn on RCSB PDB site
Description: Crystal structure of chloroplastic ascorbate peroxidase from tobacco plants and structural insights for its instability
Deposited on 2002-09-03, released 2003-09-03
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-14, with a file datestamp of 2003-10-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1iyna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iynA (A:)
    aasdsaqlksaredikellktkfchpimvrlgwhdagtynknieewpqrggangslrfdv
    elkhganaglvnalnllkpikdkysgvtyadlfqlasataieeaggpkipmkygrvdvte
    peqcpeegrlpdagppspaqhlrdvfyrmglndkeivalsgahtlgrsrpdrsgwgkpet
    kytkdgpgapggqswtaqwlkfdnsyfkdikerrdedllvlptdaalfedpsfkvyaeky
    aadpeaffkdyaeahaklsnlgakfgpaegfslegspagaapekfvaakystgkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iynA (A:)
    aasdsaqlksaredikellktkfchpimvrlgwhdagtynknieewpqrggangslrfdv
    elkhganaglvnalnllkpikdkysgvtyadlfqlasataieeaggpkipmkygrvdvte
    peqcpeegrlpdagppspaqhlrdvfyrmglndkeivalsgahtlgrsrpdrsgwgkpet
    kytkdgpgapggqswtaqwlkfdnsyfkdikerrdedllvlptdaalfedpsfkvyaeky
    aadpeaffkdyaeahaklsnlgakfgpaegfsleg