PDB entry 1iyh
View 1iyh on RCSB PDB site
Description: crystal structure of hematopoietic prostaglandin d synthase
Class: isomerase
Keywords: hematopoietic prostaglandin d synthase, pgds, gst, sigma-class gst, ligase, isomerase
Deposited on
2002-08-26, released
2003-04-08
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hematopoietic prostagladin d synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1iyha1, d1iyha2 - Chain 'B':
Compound: hematopoietic prostagladin d synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1iyhb1, d1iyhb2 - Chain 'C':
Compound: hematopoietic prostagladin d synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1iyhc1, d1iyhc2 - Chain 'D':
Compound: hematopoietic prostagladin d synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1iyhd1, d1iyhd2 - Heterogens: MG, GSH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1iyhA (A:)
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
qaipavanwikrrpqtkl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1iyhB (B:)
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
qaipavanwikrrpqtkl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1iyhC (C:)
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
qaipavanwikrrpqtkl
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1iyhD (D:)
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
qaipavanwikrrpqtkl