PDB entry 1iyg

View 1iyg on RCSB PDB site
Description: Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA
Class: structural genomics, unknown function
Keywords: MOUSE cDNA, FIS1P, CGI-135, STRUCTURAL GENOMICS, Hypothetical protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2002-08-14, released 2003-02-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein (2010003O14)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CQ92 (7-126)
      • cloning artifact (0-6)
      • cloning artifact (127-132)
    Domains in SCOPe 2.05: d1iyga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iygA (A:)
    gssgssgmeavlnelvsvedlknferkfqseqaagsvskstqfeyawclvrskynedirr
    givlleellpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerl
    idkamkksgpssg