PDB entry 1iyg

View 1iyg on RCSB PDB site
Description: Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA
Class: structural genomics, unknown function
Keywords: MOUSE cDNA, FIS1P, CGI-135, STRUCTURAL GENOMICS, Hypothetical protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2002-08-14, released 2003-02-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-02-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein (2010003O14)
  Species: MUS MUSCULUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CQ92 (7-126)
    • cloning artifact (0-6)
    • cloning artifact (127-132)
  Domains in SCOP 1.75: d1iyga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iygA (A:)
  gssgssgmeavlnelvsvedlknferkfqseqaagsvskstqfeyawclvrskynedirr
  givlleellpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerl
  idkamkksgpssg