PDB entry 1iyf

View 1iyf on RCSB PDB site
Description: Solution structure of ubiquitin-like domain of human parkin
Class: ligase
Keywords: Ubiquitin fold, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE
Deposited on 2002-08-13, released 2003-03-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parkin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1iyfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iyfA (A:)
    gplgsmivfvrfnsshgfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelrndwt
    vqncdldqqsivhivqrpwrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iyfA (A:)
    mivfvrfnsshgfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelrndwtvqncd
    ldqqsivhivqrpwrk